G6PC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16234T
Article Name: G6PC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16234T
Supplier Catalog Number: CNA16234T
Alternative Catalog Number: MBL-CNA16234T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human G6PC3 (NP_612396.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 92579
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSRWVRVMPSLAY
Target: G6PC3
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200