PLGF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16257T
Article Name: PLGF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16257T
Supplier Catalog Number: CNA16257T
Alternative Catalog Number: MBL-CNA16257T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-221 of human PLGF (NP_002623.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 5228
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Target: PGF
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200