OPN4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16289T
Article Name: OPN4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16289T
Supplier Catalog Number: CNA16289T
Alternative Catalog Number: MBL-CNA16289T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 365-489 of human OPN4 (NP_001025186.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 94233
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
Target: OPN4
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200