[KO Validated] Insulin-degrading enzyme (IDE) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1630S
Article Name: [KO Validated] Insulin-degrading enzyme (IDE) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1630S
Supplier Catalog Number: CNA1630S
Alternative Catalog Number: MBL-CNA1630S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) (NP_004960.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 118kDa
NCBI: 3416
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYS
Target: IDE
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100