TERF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16316T
Article Name: TERF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16316T
Supplier Catalog Number: CNA16316T
Alternative Catalog Number: MBL-CNA16316T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TERF2 (NP_005643.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 7014
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDK
Target: TERF2
Application Dilute: WB: WB,1:500 - 1:2000