ATP6V0C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16350P
Article Name: ATP6V0C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16350P
Supplier Catalog Number: CNA16350P
Alternative Catalog Number: MBL-CNA16350P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6V0C (NP_001185498.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 527
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG
Target: ATP6V0C
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200