ECM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16368T
Article Name: ECM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16368T
Supplier Catalog Number: CNA16368T
Alternative Catalog Number: MBL-CNA16368T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-405 of human ECM1 (NP_004416.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 1893
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNY
Target: ECM1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200