Filamin A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16376S
Article Name: Filamin A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16376S
Supplier Catalog Number: CNA16376S
Alternative Catalog Number: MBL-CNA16376S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2348-2647 of human Filamin A (NP_001104026.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 281kDa
NCBI: 2316
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPC
Target: FLNA
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200