NUBP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16403T
Article Name: NUBP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16403T
Supplier Catalog Number: CNA16403T
Alternative Catalog Number: MBL-CNA16403T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 4682
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Target: NUBP1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200