CAMP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1640P
Article Name: CAMP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1640P
Supplier Catalog Number: CNA1640P
Alternative Catalog Number: MBL-CNA1640P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human CAMP (NP_004336.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 820
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: IIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Target: CAMP
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200