OR1A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16453T
Article Name: OR1A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16453T
Supplier Catalog Number: CNA16453T
Alternative Catalog Number: MBL-CNA16453T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR1A1 (NP_055380.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 8383
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQ
Target: OR1A1
Application Dilute: WB: WB,1:500 - 1:2000