HDAC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16462T
Article Name: HDAC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16462T
Supplier Catalog Number: CNA16462T
Alternative Catalog Number: MBL-CNA16462T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human HDAC3 (O15379).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 8841
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Target: HDAC3
Application Dilute: WB: WB,1:500 - 1:2000