ACHA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1648S
Article Name: ACHA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1648S
Supplier Catalog Number: CNA1648S
Alternative Catalog Number: MBL-CNA1648S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-242 of human ACHA4 (P43681).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 1137
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRL
Target: CHRNA4
Application Dilute: WB: WB,1:500 - 1:2000