CAND2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16500T
Article Name: CAND2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16500T
Supplier Catalog Number: CNA16500T
Alternative Catalog Number: MBL-CNA16500T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 135kDa
NCBI: 23066
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD
Target: CAND2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200