RAB26 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16509T
Article Name: RAB26 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16509T
Supplier Catalog Number: CNA16509T
Alternative Catalog Number: MBL-CNA16509T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 25837
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
Target: RAB26
Application Dilute: WB: WB,1:500 - 1:1000