CKLF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16528T
Article Name: CKLF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16528T
Supplier Catalog Number: CNA16528T
Alternative Catalog Number: MBL-CNA16528T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 51192
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDNVQPKIKHRPFCFSVKGHVKMLRLVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Target: CKLF
Application Dilute: WB: WB,1:500 - 1:2000