SLAMF7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16565T
Article Name: SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16565T
Supplier Catalog Number: CNA16565T
Alternative Catalog Number: MBL-CNA16565T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-226 of human SLAMF7 (NP_067004.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 57823
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Target: SLAMF7
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200