STARD3NL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16579T
Article Name: STARD3NL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16579T
Supplier Catalog Number: CNA16579T
Alternative Catalog Number: MBL-CNA16579T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 83930
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL
Target: STARD3NL
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200