Steroidogenic factor-1 (SF-1/NR5A1) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Steroidogenic factor-1 (SF-1/NR5A1) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA1657T
• Supplier Catalog Number: CNA1657T
• Alternative Catalog Number: MBL-CNA1657T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Steroidogenic factor-1 (SF-1/Steroidogenic factor-1 (SF-1/NR5A1)) (NP_004950.2).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 52kDa
• NCBI: 2516
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
• Target: NR5A1

Application Notes

• Application Dilute: WB: WB,1:500 - 1:1000