PTPN5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16585P
Article Name: PTPN5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16585P
Supplier Catalog Number: CNA16585P
Alternative Catalog Number: MBL-CNA16585P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 190-307 of human PTPN5 (NP_116170.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 84867
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEI
Target: PTPN5
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200