ARHGAP11B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16587T
Article Name: ARHGAP11B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16587T
Supplier Catalog Number: CNA16587T
Alternative Catalog Number: MBL-CNA16587T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 218-267 of human ARHGAP11B (NP_001034930.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 89839
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV
Target: ARHGAP11B
Application Dilute: WB: WB,1:100 - 1:500