Epn2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16623T
Article Name: Epn2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16623T
Supplier Catalog Number: CNA16623T
Alternative Catalog Number: MBL-CNA16623T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse Epn2 (XP_006532226.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 13855
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
Target: Epn2
Application Dilute: WB: WB,1:500 - 1:1000