Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16631T
Article Name: Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16631T
Supplier Catalog Number: CNA16631T
Alternative Catalog Number: MBL-CNA16631T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (Q16881).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 7296
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV
Target: TXNRD1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200