IGFBPL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16635T
Article Name: IGFBPL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16635T
Supplier Catalog Number: CNA16635T
Alternative Catalog Number: MBL-CNA16635T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human IGFBPL1 (NP_001007564.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 347252
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVG
Target: IGFBPL1
Application Dilute: WB: WB,1:500 - 1:2000