UGT2B15 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16657T
Article Name: UGT2B15 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16657T
Supplier Catalog Number: CNA16657T
Alternative Catalog Number: MBL-CNA16657T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 7366
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLF
Target: UGT2B15
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200