[KO Validated] PDK1/PDPK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1665T
Article Name: [KO Validated] PDK1/PDPK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1665T
Supplier Catalog Number: CNA1665T
Alternative Catalog Number: MBL-CNA1665T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 409-556 of human PDK1/PDPK1 (NP_002604.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 5170
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Target: PDPK1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200