CD147/BSG Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16662T
Article Name: CD147/BSG Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16662T
Supplier Catalog Number: CNA16662T
Alternative Catalog Number: MBL-CNA16662T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD147/CD147/BSG (NP_001719.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 682
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Target: BSG
Application Dilute: WB: WB,1:500 - 1:1000