Fibronectin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16678P
Article Name: Fibronectin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16678P
Supplier Catalog Number: CNA16678P
Alternative Catalog Number: MBL-CNA16678P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2200-2355 of human Fibronectin (NP_002017.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 272kDa
NCBI: 2335
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Target: FN1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200