Vitronectin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1667S
Article Name: Vitronectin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1667S
Supplier Catalog Number: CNA1667S
Alternative Catalog Number: MBL-CNA1667S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 364-478 of human Vitronectin (NP_000629.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 7448
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Target: VTN
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200