LSM14A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16682T
Article Name: LSM14A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16682T
Supplier Catalog Number: CNA16682T
Alternative Catalog Number: MBL-CNA16682T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSM14A (NP_001107565.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 26065
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS
Target: LSM14A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200