ERK1 / ERK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16686P
Article Name: ERK1 / ERK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16686P
Supplier Catalog Number: CNA16686P
Alternative Catalog Number: MBL-CNA16686P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK1 / ERK2 (NP_620407.1/NP_002737.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 36kDa/41kDa/38kDa/40kDa/43kDa
NCBI: 5594
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Target: MAPK1/MAPK3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200