CDKL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16689T
Article Name: CDKL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16689T
Supplier Catalog Number: CNA16689T
Alternative Catalog Number: MBL-CNA16689T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKL3 (NP_001107047).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 51265
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN
Target: CDKL3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200