Neuropilin-1 (NRP1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16697P
Article Name: Neuropilin-1 (NRP1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16697P
Supplier Catalog Number: CNA16697P
Alternative Catalog Number: MBL-CNA16697P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Neuropilin-1 (NRP1) (NP_003864.5).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 8829
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: IDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA
Target: NRP1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200