Collagen I/COL1A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16699S
Article Name: Collagen I/COL1A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16699S
Supplier Catalog Number: CNA16699S
Alternative Catalog Number: MBL-CNA16699S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen I/COL1A2 (NP_000080.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 129kDa
NCBI: 1278
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA
Target: COL1A2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200