MARK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16706T
Article Name: MARK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16706T
Supplier Catalog Number: CNA16706T
Alternative Catalog Number: MBL-CNA16706T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-455 of human MARK2 (Q7KZI7).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 88kDa
NCBI: 2011
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RYNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPA
Target: MARK2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100