Kininogen 1 (KNG1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1670P
Article Name: Kininogen 1 (KNG1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1670P
Supplier Catalog Number: CNA1670P
Alternative Catalog Number: MBL-CNA1670P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-374 of human Kininogen 1 (KNG1) (NP_001095886.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 3827
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPT
Target: KNG1
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200