AMOTL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16723P
Article Name: AMOTL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16723P
Supplier Catalog Number: CNA16723P
Alternative Catalog Number: MBL-CNA16723P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 638-837 of human AMOTL2 (NP_001265612.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 51421
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: RQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI
Target: AMOTL2
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100