[KO Validated] TFAP4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16727T
Article Name: [KO Validated] TFAP4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16727T
Supplier Catalog Number: CNA16727T
Alternative Catalog Number: MBL-CNA16727T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-342 of human TFAP4 (NP_003214.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 7023
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Target: TFAP4
Application Dilute: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200