ABCA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16735T
Article Name: ABCA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16735T
Supplier Catalog Number: CNA16735T
Alternative Catalog Number: MBL-CNA16735T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-350 of human ABCA2 (NP_001597.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 270kDa
NCBI: 20
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPNSTAQALLAARVDPPEVYHLLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEELLLAPALLEQLTCTPGSGELGRILTVPESQKGALQGYRDAVCSGQAAARARRFSGLSAELRNQLDVAKVSQQLGLDAPNGSDSSPQAPPPRRLQALLGDLLDAQKVLQDVDVLSALALLLPQG
Target: ABCA2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200