MAPK1/MAPK3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16736T
Article Name: MAPK1/MAPK3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16736T
Supplier Catalog Number: CNA16736T
Alternative Catalog Number: MBL-CNA16736T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MAPK1/MAPK3 (NP_620407.1/NP_002737.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 36kDa/38kDa/40kDa/41kDa/43kDa
NCBI: 5594
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Target: MAPK1/MAPK3
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:100 - 1:200