IL18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16737P
Article Name: IL18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16737P
Supplier Catalog Number: CNA16737P
Alternative Catalog Number: MBL-CNA16737P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human IL18 (NP_001553.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 3606
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI
Target: IL18
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200