Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16750T
Article Name: Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16750T
Supplier Catalog Number: CNA16750T
Alternative Catalog Number: MBL-CNA16750T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 395-609 of Alpha-Fetoprotein (AFP) (NP_001125.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 174
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Target: AFP
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100