Caspase-1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA16792S1
| Article Name: |
Caspase-1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA16792S1 |
| Supplier Catalog Number: |
CNA16792S1 |
| Alternative Catalog Number: |
MBL-CNA16792S1 |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 120-297 of human Caspase-1 (NP_150634.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
45kDa |
| NCBI: |
834 |
| Buffer: |
PBS with 0.09% Sodium azide,50% glycerol |
| Source: |
Rabbit |
| Sequence: |
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD |
| Target: |
CASP1 |
| Application Dilute: |
WB: WB,1:100 - 1:500 |
