Caspase-3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16793T
Article Name: Caspase-3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16793T
Supplier Catalog Number: CNA16793T
Alternative Catalog Number: MBL-CNA16793T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 836
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Target: CASP3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200