[KO Validated] CDK4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16813T
Article Name: [KO Validated] CDK4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16813T
Supplier Catalog Number: CNA16813T
Alternative Catalog Number: MBL-CNA16813T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 1019
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Target: CDK4
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000