CD52 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16815P
Article Name: CD52 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16815P
Supplier Catalog Number: CNA16815P
Alternative Catalog Number: MBL-CNA16815P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-61 of human CD52 (NP_001794.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 7kDa
NCBI: 1043
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Target: CD52
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100