CHRM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16819T
Article Name: CHRM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16819T
Supplier Catalog Number: CNA16819T
Alternative Catalog Number: MBL-CNA16819T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 264-340 of human CHRM1 (NP_000729.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 1128
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKG
Target: CHRM1
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200