CTBP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16826T
Article Name: CTBP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16826T
Supplier Catalog Number: CNA16826T
Alternative Catalog Number: MBL-CNA16826T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CTBP2 (NP_001320.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 1488
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
Target: CTBP2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200