EGFR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16840T
Article Name: EGFR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16840T
Supplier Catalog Number: CNA16840T
Alternative Catalog Number: MBL-CNA16840T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 134kDa
NCBI: 1956
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
Target: EGFR
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200