Glucosylceramidase beta (GBA) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Glucosylceramidase beta (GBA) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA16860S
• Supplier Catalog Number: CNA16860S
• Alternative Catalog Number: MBL-CNA16860S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-250 of human Glucosylceramidase beta (Glucosylceramidase beta (GBA)) (NP_000148.2).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 60kDa
• NCBI: 2629
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWAR
• Target: GBA1

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000